PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa18g011000.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family bZIP
Protein Properties Length: 353aa    MW: 39638 Da    PI: 10.1373
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa18g011000.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_133.31e-10276326454
                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     +k+ +rk+kNRe+A rsR+RK+a++ eLe +  +L+++ ++L ke   ++k
  Csa18g011000.1 276 DKKLKRKIKNRESAARSRARKQAKTMELELELGNLKKKYQELLKEQVDMRK 326
                     89*************************************988877555444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.9E-9272326No hitNo description
SMARTSM003380.0025273330IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.749275326IPR004827Basic-leucine zipper domain
CDDcd147074.51E-18277331No hitNo description
SuperFamilySSF579591.25E-8277326No hitNo description
PfamPF077163.9E-8277325IPR004827Basic-leucine zipper domain
PROSITE patternPS000360280295IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MDSYWRLKSL VNDFPVSRQG SIYSWTVDEF QTSLGKKCGS MNMDELVKNI SSAEETQEGL  60
KRQGSISLPR TLSQKPVDEV WKYITQEDNT KNNGVTKVPD HLQRQQTLGD ITLEEFLTRS  120
GAKVNNMNTG LGVQFQPKAM VSDFTNNIVP RCHDSNMHQN VNGSMSTYQP QQCIMCKPNG  180
YSYVGQQIRI SNGVTGFIDQ TVQAEKKSLV PRVTTNPSGA IACSSVNPYP ILNKMQNNDG  240
TSSLLSPSLN IYSGSTSTTR GRKIDNTVAA DNKITDKKLK RKIKNRESAA RSRARKQAKT  300
MELELELGNL KKKYQELLKE QVDMRKMQTE PGMIQLQGRP ERKLRRTNSD IM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010484882.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 8
SwissprotQ9FMM71e-166AI5L8_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 8
TrEMBLR0EYV11e-167R0EYV1_9BRAS; Uncharacterized protein
STRINGAT5G42910.11e-164(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156311417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42910.11e-137bZIP family protein